PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g01140.1.p
Common NameBRADI_4g01140, LOC100832709
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 322aa    MW: 36439.2 Da    PI: 7.8888
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g01140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA24.73.2e-08158186131
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                       Cs C + +Tp+W  gp+g   LCnaCGl+ +
  Bradi4g01140.1.p 158 CSYCLSNQTPQWWDGPSGV--LCNACGLRLQ 186
                       9************999885..5******976 PP

2GATA53.82.6e-17251285135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Bradi4g01140.1.p 251 CTHCMSHKTPQWRTGPLGPKTLCNACGVRYKSGRL 285
                       *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.38E-7151200No hitNo description
PROSITE profilePS501149.75152183IPR000679Zinc finger, GATA-type
SMARTSM004014.3E-5152201IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-8157187IPR013088Zinc finger, NHR/GATA-type
SMARTSM004014.4E-15245299IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.345245281IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.42E-14249309No hitNo description
Gene3DG3DSA:3.30.50.102.5E-13250283IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.28E-12250301No hitNo description
PfamPF003204.4E-15251285IPR000679Zinc finger, GATA-type
PROSITE patternPS003440251276IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDVRRQPNVA AAAAAAAAAT LGDLFPHQPA MDSGDNNTEW LSIYLEDCLS THPVSAEQAS  60
QGAVKQKLPP PSSSNARRKK RSLASVIRDE EEHCFTVFVE PPLLLPDQKH WLAESELILP  120
KKDKDQELVQ QQEQEHEEEK KRNASAEMLF QQEQMLVCSY CLSNQTPQWW DGPSGVLCNA  180
CGLRLQAGNE FSSMERCGQE ISKEQEQGKR QEKRRIKRPA YIDEELPQKK RTKKTTYVNE  240
ELPPEEPVQR CTHCMSHKTP QWRTGPLGPK TLCNACGVRY KSGRLLPEYR PANSPTFSSY  300
MHSNSHKKVM QMRKSVEHSG Q*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1211218EKRRIKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579113.10.0PREDICTED: GATA transcription factor 2-like
TrEMBLI1IG870.0I1IG87_BRADI; Uncharacterized protein
STRINGBRADI4G01140.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.12e-34GATA transcription factor 4